PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.196850.1
Common NameCsa_1G004900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 472aa    MW: 54875.1 Da    PI: 6.2383
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.196850.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.83e-19194240148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEd ll+++v+q+G + W+ Iar+++ gR +kqc++rw+++l
   Cucsa.196850.1 194 KGQWTVEEDRLLIQLVEQYGVRKWSHIARMLP-GRIGKQCRERWHNHL 240
                      799*****************************.*************97 PP

2Myb_DNA-binding54.23.3e-17246288145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ W++eEd  l++a+ + G++ W+ Ia++++ gRt++++k++w+
   Cucsa.196850.1 246 KDTWSEEEDRVLIEAHSEIGNK-WAEIAKRLP-GRTENSIKNHWN 288
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129432.155189244IPR017930Myb domain
SuperFamilySSF466898.27E-33191287IPR009057Homeodomain-like
SMARTSM007173.2E-19193242IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-28195248IPR009057Homeodomain-like
CDDcd001673.48E-16197240No hitNo description
PfamPF139215.3E-20197254No hitNo description
PROSITE profilePS5129422.266245295IPR017930Myb domain
SMARTSM007171.1E-16245293IPR001005SANT/Myb domain
CDDcd001676.84E-12248291No hitNo description
Gene3DG3DSA:1.10.10.605.3E-22249293IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MELESNLREE NLSTEICKKD ELLSSFENFA SAKGNNYLQE FHHLDHQLHP IANSSSNNHV  60
MEDENLCSNF DSLNNNQYSH GIDQEMYEFN YKGNAAADQV MDNFQNCGDY YYYCNNFHQR  120
NHQIEIMGLE RNSINIPLNF PEIKPVNFMV PDEVSSIDSA RNGHIQKGII NNKNVNFSSL  180
LRTSKGRKKP NVIKGQWTVE EDRLLIQLVE QYGVRKWSHI ARMLPGRIGK QCRERWHNHL  240
RPDIKKDTWS EEEDRVLIEA HSEIGNKWAE IAKRLPGRTE NSIKNHWNAT KRRQYSKRKC  300
RSKYPRCSLL QDYIKSLNLD SNTAVRHQKK SSAAISSAVN NNNKSKSADQ HYHHQVQTTD  360
FCPNDWTVPD FDFKEEPEFY LDDSFFPEGC SINSLMEDIV GASVDEANNY DRKRYNDNND  420
ESVELRCVEM NKLQYYAPVS TAVAGMEFEV KKELDLVEMM TQVNEVNSMM K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-4519029454158MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-4519029454158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818130.0LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453673.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L26e-96MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A0A0LRG50.0A0A0A0LRG5_CUCSA; Uncharacterized protein
STRINGGLYMA05G02300.21e-131(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15703196
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.13e-92myb domain protein 98
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]